← Cockpit
INF_025predictionRoboticshumanoid-deployment

Figure AI targets deployment of 100,000 general-purpose humanoid robots by 2029, networked to a centralized 'universal brain' capable of controlling any robot body on Earth — requiring continuous high-bandwidth DC-to-edge data streams.

Predictor: Brett Adcock

Prior probability
40.0%
Current probability
37.1%
evolves via intake + LBP
Conviction
5/5
Signal quality
A
Resolution
pending
Window
2029-01-01 – 2029-09-30
Edges in / out
4 / 0
Tickers exposed
25

Prediction text

Figure AI targets deployment of 100,000 general-purpose humanoid robots by 2029, networked to a centralized 'universal brain' capable of controlling any robot body on Earth — requiring continuous high-bandwidth DC-to-edge data streams. | BotQ production ramp; 2nd BMW expansion or new OEM deal

Key catalyst: BotQ production ramp; 2nd BMW expansion or new OEM deal

Watch events: BotQ output ramp; Figure 2nd commercial customer; universal brain API release

Resolution evidence

Status: pending

BotQ capacity 12K/yr; Figure 03 commercially deployed at BMW 5+ months. 100K by 2029 requires ~25K units/yr run-rate by 2028.

Predictor: Brett Adcock

κ + Brier as of 2026-05-22
κ (discount)
0.773
Brier
0.0040
excellent
Hits / Misses
5 / 0
of 6 resolved
Hit rate
83.3%
Calibration plot (stated vs observed)

Evidence about this node from Brett Adcock is multiplied by κ in /api/intake. Lower κ = less weight; floors at 0.10 (effectively silenced) and caps at 1.00 (full weight).

Reference class: humanoid_commercial_volume

Linked via embedding similarity 0.722

>10,000 unit cumulative deployment of humanoid robot SKU within 3 years of debut

Base rate
10.0%
0/3 historical
Inside weight
Outside weight
no pull
inside 37.1% → blend 37.1% 0.0pp)

Tetlock-style outside view: at TRF=1 (just predicted), outside view dominates (w_in=0.3). At TRF=0 (deadline), inside view dominates (w_in=1.0). The blend regularizes overconfident inside views toward the historical base rate.

Probability over time

6 prob_history rows
0%25%50%75%100%prior 40%2026-04-302026-05-102026-05-24
intake v2milestone miss sweeplbp propagationreference class assignedlegacy v1prior_prob (analyst seed)current = 37.1%

Milestone chain

Pre-event signals (upstream prereqs + window checkpoints) → resolution event → downstream cascades. Status/dates update from linked nodes; re-derive nightly via scripts/ops/derive_milestones.py.
Leading chain: 4 pending
  1. 2029-02-27pendingQ1 window check-in (25%)
  2. 2029-04-25pendingQ2 window check-in (50%)
  3. 2029-06-21pendingQ3 window check-in (75%)

No downstream cascades — this prediction is a leaf in the dependency graph.

What if this resolves?

Clamp this prediction TRUE or FALSE and run a counterfactual Gibbs sample. Surfaces the predictions whose marginals shift most under that assumption.
(live posterior: 37%)

Click a button to clamp this prediction and run a Gibbs sample. Returns the predictions whose marginals shift most. ~30s per run; ideal for stress-testing "if X resolves, what else moves?"

Evidence chain

Every probability update with full Bayesian provenance — chronological, latest first
LBP2026-05-24T02:00:02Z37.1%+1.6pp
Network propagation: 35.5% → 37.1%
4-iter LBP, residual 0.01000 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 806b02f8
LBP2026-05-17T02:00:01Z35.5%+3.1pp
Network propagation: 32.4% → 35.5%
5-iter LBP, residual 0.00689 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e607fa96
LBP2026-05-10T02:00:02Z32.4%+5.8pp
Network propagation: 26.6% → 32.4%
6-iter LBP, residual 0.00584 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e5c18d29
LBP2026-05-03T02:00:01Z26.6%+9.3pp
Network propagation: 17.3% → 26.6%
6-iter LBP, residual 0.00677 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 1a683ac9
legacy v12026-04-30T19:17:54Z17.3%-22.7pp
intake:99aa73db-75b1-4b1e-8470-a11f87b23937 bayesian_v2 inside=0.477 blend=0.173 LLR=0.313 κ=0.77 w_in=0.30 humanoid_commercial_volume
legacy v12026-04-30T01:56:50Z16.0%-24.0pp
reference_class_assigned bayesian_v2 inside=0.400 blend=0.160 w_in=0.30 humanoid_commercial_volume

Network propagation neighbors

Top edges sorted by latest LBP cross-impact
All propagation →

No propagation data yet. Run inference/.venv/bin/python scripts/ops/run_loopy_belief_propagation.py on the droplet, or wait for the Sunday 02:00 UTC weekly cron.

Ticker exposure

25 ticker(s) linked

Beneficiaries (22)

LYSCFSYMHSEHYMPALNTSERVRNSHFFANUYIRBTUSARMIELYAMZNBYDDYHYMTFIFNNYABBNYPHTERTSLATXNSTMTEL

Adverse (3)

RHIKFYMAN

Prerequisites (4)

Predictions that must hit first
TypePredTitleDomainLag
correlateS_HUMANOID_ENTERPRISE_2028Humanoid R2: 100K+ enterprise by Nov 2028humanoid_deployment
correlateS_HUMANOID_FACTORY_2026Humanoid R1: 10K+ factory units by Nov 2026humanoid_deployment
correlateS_HUMANOID_CONSUMER_2030Humanoid R3: 1M+ consumer by Nov 2030humanoid_deployment
correlateS_HUMANOID_MASS_2033Humanoid R4: 10M+ cumulative by Dec 2033humanoid_deployment

Dependents (0)

Predictions enabled by this
TypePredTitleDomainLag
No dependents

Expected milestones (1)

From Sheet 17 Monitoring Triggers
Expected byDescriptionStatus
2029-12-31[Robotics 2029-12] [INF_025] BotQ output ramp; Figure 2nd commercial customer; universal brain API release [235_020] Figure 03 shipment volume; BMW, 2nd customer deployment count; BLS employment reports; tech layoff t [229_003]pending

Linked documents (5)

Auto-generated by cosine similarity from Polymarket / Manifold / EDGAR / GDELT
SimSourceTitleMarket probPolarityReviewedPublished
0.676arxivHANDOFF: Humanoid Agentic Task-Space Whole-Body Control via Distilled Complementary Teachersmentionspending2026-06-04
0.616arxivHeight Control and Optimal Torque Planning for Jumping With Wheeled-Bipedal Robotsmentionspending2026-05-05
0.611arxivLearning Action-Conditional and Object-Centric Gaussian Splatting World Models for Rigid Objectsmentionspending2026-06-01
0.550codex_research_packFigure - Ramping Figure 03 Productioncorroboratespending2026-04-29
0.550codex_research_packFigure - BotQ: A High-Volume Manufacturing Facility for Humanoid Robotscorroboratespending2025-03-16

Raw metadata

From Thesis_Timeline_v1.0_FINAL workbook
{
  "nia": false,
  "qty": "100K humanoids",
  "mode": "FORECAST",
  "role": "Cited-CEO",
  "context": "BotQ facility at 12,000 units/year; BMW commercial deployment. Universal-brain approach implies networking scale beyond current internet topology.",
  "to_year": 2029,
  "conv_cues": "specific unit count; CEO FIRST_PERSON",
  "direction": "NUMERIC_TARGET",
  "from_year": 2029,
  "timeframe": "by 2029",
  "conv_level": "HIGH",
  "milestones": [
    {
      "kind": "scenario_signal",
      "label": "Scenario fires: Humanoid R2: 100K+ enterprise by Nov 2028",
      "status": "pending",
      "weight": 0.7,
      "ordinal": -4,
      "source_id": "S_HUMANOID_ENTERPRISE_2028",
      "expected_date": "2028-11-30",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q1 window check-in (25%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -3,
      "source_id": null,
      "expected_date": "2029-02-27",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q2 window check-in (50%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -2,
      "source_id": null,
      "expected_date": "2029-04-25",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q3 window check-in (75%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -1,
      "source_id": null,
      "expected_date": "2029-06-21",
      "observed_date": null
    },
    {
      "kind": "event",
      "label": "Figure AI targets deployment of 100,000 general-purpose humanoid robots by 2029, networked to a centralized 'universal brain' capable of con",
      "status": "pending",
      "weight": 1,
      "ordinal": 0,
      "source_id": "INF_025",
      "expected_date": "2029-08-18",
      "observed_date": null
    }
  ],
  "repeat_eps": 1,
  "affiliation": "Figure AI",
  "attribution": "FIRST_PERSON",
  "granularity": "YEAR",
  "source_refs": "38",
  "target_date": "2029-06-15T00:00:00",
  "display_date": "2029-08-18",
  "episode_date": "2026-04-21T00:00:00",
  "key_catalyst": "BotQ production ramp; 2nd BMW expansion or new OEM deal",
  "parse_method": "YEAR midpoint",
  "domain_bucket": "Robotics",
  "episode_title": "The Architecture of Intelligence: AI Infrastructure, Energy & Networking Predictions (2023-2026)",
  "fault_line_id": "F005",
  "flag_repeated": false,
  "in_5yr_window": true,
  "source_report": "AI_Leaders_Infrastructure_Predictions.md (2026-04-21)",
  "appears_in_eps": "INF-RPT",
  "futurist_phase": "Phase 2 (2027-2028)",
  "is_macro_claim": false,
  "total_mentions": 1,
  "priority_weight": 5,
  "ps_cluster_tags": [
    "C8"
  ],
  "report_evidence": "Links physical robotics to the DC networking infrastructure thesis in Section 6.3.",
  "active_end_month": "2029-12",
  "recent_statement": "Adcock Jan 2026: humanoids doing unsupervised multi-day tasks in unfamiliar homes in 2026; universal brain development ongoing.",
  "watch_events_raw": "BotQ output ramp; Figure 2nd commercial customer; universal brain API release",
  "months_from_today": 38,
  "probability_layer": "Base-case",
  "active_start_month": "2029-01",
  "december_dispersal": {
    "reason": "december_dispersal: domain=Robotics → 09/2029",
    "new_date": "2029-09-30",
    "old_date": "2029-12-31",
    "applied_at": "2026-04-30T16:28:34.304992+00:00"
  },
  "flag_nia_bracketed": false,
  "track_record_grade": "B",
  "track_record_notes": "Figure has shipped 3 generations in 3.5 years (faster than Tesla's Optimus); BMW deployment validated. Adcock hits directional targets; specific unit counts often slip.",
  "contradicting_notes": "Tesla Optimus, 1X, Agility, Apptronik all competing; market absorption of 100K units in 3 years uncertain.",
  "flag_near_term_2027": true,
  "flag_high_conviction": true,
  "milestones_phase2_at": "2026-05-01T21:12:50.936568+00:00",
  "milestones_derived_at": "2026-05-02T03:08:50.969055+00:00",