← Cockpit
IND_023predictionRoboticsbipedal-robotics-municipal-utility

'Cambrian explosion of bipedal labor' driven by hundreds of robotics companies — autonomy graduates from pilot programs to municipal public utilities by 2026; rupture of psychological firewall between humans and synthetic minds; AI soon optimizes its o...

Predictor: Alex Wissner-Gross

Prior probability
48.0%
Current probability
22.0%
evolves via intake + LBP
Conviction
5/5
Signal quality
C
Resolution
in_progress
Window
2026-01-01 – 2026-10-31
Edges in / out
4 / 0
Tickers exposed
22

Prediction text

'Cambrian explosion of bipedal labor' driven by hundreds of robotics companies — autonomy graduates from pilot programs to municipal public utilities by 2026; rupture of psychological firewall between humans and synthetic minds; AI soon optimizes its own logic to solve fundamental mathematical and scientific problems autonomously. | First city/state humanoid-as-service contract

Key catalyst: First city/state humanoid-as-service contract

Watch events: First municipal-government humanoid deployment contract

Resolution evidence

Status: in_progress

Figure, Tesla Optimus, Agility Digit, Apptronik, 1X, Sanctuary AI, Unitree, Xpeng — hundreds of humanoid companies confirm Cambrian framing. Municipal utility-grade deployment nascent.

Predictor: Alex Wissner-Gross

κ + Brier as of 2026-05-22
κ (discount)
0.844
Brier
0.0341
excellent
Hits / Misses
6 / 1
of 11 resolved
Hit rate
54.5%
Calibration plot (stated vs observed)

Evidence about this node from Alex Wissner-Gross is multiplied by κ in /api/intake. Lower κ = less weight; floors at 0.10 (effectively silenced) and caps at 1.00 (full weight).

Reference class: humanoid_commercial_volume

Linked via embedding similarity 0.636

>10,000 unit cumulative deployment of humanoid robot SKU within 3 years of debut

Base rate
10.0%
0/3 historical
Inside weight
0.646
TRF=0.51
Outside weight
0.354
pulling toward base rate
inside 32.0% → blend 22.0% -10.0pp)

Tetlock-style outside view: at TRF=1 (just predicted), outside view dominates (w_in=0.3). At TRF=0 (deadline), inside view dominates (w_in=1.0). The blend regularizes overconfident inside views toward the historical base rate.

Probability over time

10 prob_history rows
0%25%50%75%100%prior 48%2026-04-302026-05-032026-05-30
intake v2milestone miss sweeplbp propagationreference class assignedlegacy v1prior_prob (analyst seed)current = 22.0%

Milestone chain

Pre-event signals (upstream prereqs + window checkpoints) → resolution event → downstream cascades. Status/dates update from linked nodes; re-derive nightly via scripts/ops/derive_milestones.py.
Leading chain: 2 fired ✓ · 3 overdue ⏱
  1. 2026-02-16overdueQ1 window check-in (25%)
  2. 2026-02-15hitApptronik Apollo deployed at Mercedes-Benz manufacturing plant for tote delivery
    How: Apptronik publicly confirms Apollo humanoid robots in active commercial pilot at Mercedes-Benz facility (>=1 site)
    Source: https://mlq.ai/news/apptronik-secures-520m-funding-boost-for-humanoid-robot-expansion/conf 95%
    Notes: HIT — Apptronik raised $520M Feb 2026, Apollo in pilot at Mercedes for tote delivery; supports Cambrian-explosion-of-bipedal-labor thesis.
  3. 2026-04-04overdueQ2 window check-in (50%)
  4. 2026-04-15hitFigure 03 production reaches 1 robot/hour throughput at BotQ
    How: Figure AI publicly reports BotQ producing 1 humanoid/hour (>=24x throughput improvement vs Jan 2026 rate of 1/day)
    Source: https://www.humanoidsdaily.com/news/24x-throughput-figure-scales-manufacturing-to-one-robot-per-hourconf 95%
  5. 2026-05-21overdueQ3 window check-in (75%)
  6. 2026-06-01 → 2026-10-31pendingFirst city/state municipal humanoid-as-service contract announced
    How: At least one US city or state agency announces a paid humanoid-robot deployment contract for municipal services (sanitation, security, inspection)
    Source: Industry tracking: The Robot Report, Humanoids Daily, Standard Bots top-12 humanoid companies 2026conf 25%
    Notes: Aggressive — to date (April 2026) deployments are manufacturing/logistics only; no public municipal contract yet. Gates the prediction's 'graduation to municipal public utilities' clause.
  7. 2026-06-01 → 2026-10-31pendingHundreds of robotics companies confirmed in active humanoid commercial pilots
    How: Industry tracker (e.g., Humanoids Daily, IFR) reports >=100 distinct humanoid robotics companies with at least 1 paying commercial pilot
    Source: https://www.futuremarketsinc.com/humanoid-robots-market-report-2026-2036/conf 55%
  8. 2026-09-01 → 2026-12-31pendingCumulative humanoid robots deployed in commercial workforce >=10,000 units
    How: Aggregate Tesla Optimus + Figure + Apptronik + 1X + Unitree confirmed commercial deployments cross 10,000-unit threshold
    Source: Manufacturer disclosures + industry trackersconf 35%
    Notes: Cascade — Tesla targets 10M long-term but current deployment is hundreds; 10K aggregate by year-end is plausible but not certain.

What if this resolves?

Clamp this prediction TRUE or FALSE and run a counterfactual Gibbs sample. Surfaces the predictions whose marginals shift most under that assumption.
(live posterior: 22%)

Click a button to clamp this prediction and run a Gibbs sample. Returns the predictions whose marginals shift most. ~30s per run; ideal for stress-testing "if X resolves, what else moves?"

Evidence chain

Every probability update with full Bayesian provenance — chronological, latest first
metadata_milestone_miss_sweep2026-05-30T22:15:00Z22.0%-17.8pp
metadata_milestone_miss_sweep bayesian_v2 n=1 inside=0.320 blend=0.220 LLR=-0.342 κ=0.84 w_in=0.65 humanoid_commercial_volume
Raw metadata
{
  "trf": 0.5051911152205567,
  "kappa": 0.8438,
  "base_rate": 0.1,
  "predictor": "Alex Wissner-Gross",
  "total_llr": -0.4054651081081644,
  "grace_days": 7,
  "bayesian_v2": true,
  "prior_logit": -0.4127646965523789,
  "bayes_factor": "1.4:1 against",
  "blend_reason": "blend 64% inside / 35% outside (TRF=0.505, base_rate=0.100 from humanoid_commercial_volume)",
  "inside_prior": 0.3982493844240199,
  "kappa_source": "predictor_table",
  "n_milestones": 1,
  "blend_applied": true,
  "contributions": [
    {
      "llr": -0.4054651081081644,
      "kind": "quartile_checkpoint",
      "kappa": 0.8438,
      "label": "Q3 window check-in (75%)",
      "weight": 0.05,
      "strength": "weak",
      "confidence": null,
      "source_url": null,
      "adjusted_llr": -0.3421314582216691,
      "expected_date": "2026-05-21",
      "measurement_criterion": null
    }
  ],
  "evidence_kind": "metadata_milestone_miss_sweep",
  "inside_source": "history_v2",
  "inside_weight": 0.6463662193456103,
  "outside_weight": 0.35363378065438966,
  "posterior_prob": 0.2201225753126128,
  "posterior_logit": -0.754896154774048,
  "predictor_brier": 0.03413,
  "inside_posterior": 0.3197553904489568,
  "blended_posterior": 0.2201225753126128,
  "reference_class_id": "humanoid_commercial_volume",
  "total_adjusted_llr": -0.3421314582216691,
  "predictor_n_resolved": 11
}
LBP2026-05-24T02:00:02Z39.8%+2.1pp
Network propagation: 37.7% → 39.8%
4-iter LBP, residual 0.01000 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 806b02f8
LBP2026-05-17T02:00:01Z37.7%+4.1pp
Network propagation: 33.7% → 37.7%
5-iter LBP, residual 0.00689 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e607fa96
LBP2026-05-10T02:00:02Z33.7%+7.4pp
Network propagation: 26.3% → 33.7%
6-iter LBP, residual 0.00584 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e5c18d29
LBP2026-05-03T02:00:01Z26.3%+11.2pp
Network propagation: 15.1% → 26.3%
6-iter LBP, residual 0.00677 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 1a683ac9
metadata_milestone_miss_sweep2026-05-02T22:07:21Z15.1%-18.0pp
metadata_milestone_miss_sweep bayesian_v2 n=2 inside=0.199 blend=0.151 LLR=-0.684 κ=0.84 w_in=0.58 humanoid_commercial_volume
Raw metadata
{
  "trf": 0.5976179033649615,
  "kappa": 0.8438,
  "base_rate": 0.1,
  "predictor": "Alex Wissner-Gross",
  "total_llr": -0.8109302162163288,
  "grace_days": 7,
  "bayesian_v2": true,
  "prior_logit": -0.7057261833624754,
  "bayes_factor": "2.0:1 against",
  "blend_reason": "blend 58% inside / 41% outside (TRF=0.598, base_rate=0.100 from humanoid_commercial_volume)",
  "inside_prior": 0.3305438842399614,
  "kappa_source": "predictor_table",
  "n_milestones": 2,
  "blend_applied": true,
  "contributions": [
    {
      "llr": -0.4054651081081644,
      "kind": "quartile_checkpoint",
      "kappa": 0.8438,
      "label": "Q1 window check-in (25%)",
      "weight": 0.05,
      "strength": "weak",
      "confidence": null,
      "source_url": null,
      "adjusted_llr": -0.3421314582216691,
      "expected_date": "2026-02-16",
      "measurement_criterion": null
    },
    {
      "llr": -0.4054651081081644,
      "kind": "quartile_checkpoint",
      "kappa": 0.8438,
      "label": "Q2 window check-in (50%)",
      "weight": 0.05,
      "strength": "weak",
      "confidence": null,
      "source_url": null,
      "adjusted_llr": -0.3421314582216691,
      "expected_date": "2026-04-04",
      "measurement_criterion": null
    }
  ],
  "evidence_kind": "metadata_milestone_miss_sweep",
  "inside_source": "history_v2",
  "inside_weight": 0.5816674676445269,
  "outside_weight": 0.4183325323554731,
  "posterior_prob": 0.15088432251336234,
  "posterior_logit": -1.3899890998058138,
  "predictor_brier": 0.03413,
  "inside_posterior": 0.19940949700827743,
  "blended_posterior": 0.15088432251336234,
  "reference_class_id": "humanoid_commercial_volume",
  "total_adjusted_llr": -0.6842629164433383,
  "predictor_n_resolved": 11
}
LBP2026-04-30T16:39:51Z33.1%+7.6pp
Network propagation: 25.4% → 33.1%
5-iter LBP, residual 0.00825 · damping 0.5, w_intrinsic 0.5 · method lbp_v2 · run 0c8a4ea3
legacy v12026-04-30T16:13:50Z25.4%-7.6pp
reference_class_assigned bayesian_v2 inside=0.480 blend=0.254 w_in=0.53 humanoid_commercial_volume
LBP2026-04-30T02:18:57Z33.0%+7.6pp
Network propagation: 25.4% → 33.0%
5-iter LBP, residual 0.00825 · damping 0.5, w_intrinsic 0.5 · method lbp_v1 · run 592311ef
legacy v12026-04-30T01:56:50Z25.4%-22.6pp
reference_class_assigned bayesian_v2 inside=0.480 blend=0.254 w_in=0.53 humanoid_commercial_volume

Network propagation neighbors

Top edges sorted by latest LBP cross-impact
All propagation →

Top incoming (parents)

Edges that influence THIS node's belief

KindNodeTheir probP(c|s=T)P(c|s=F)Δ implied
killerTK06
China-Taiwan Military Conflict
8.0%0.0500.480+0.225
killerTK11
Autonomous Regulatory Block (Level 4 Halt)
10.0%0.0500.480+0.217
killerTK08
Humanoid Capital Collapse (Figure/Apptronik Flop)
22.0%0.0500.480+0.165

Top outgoing (children)

Predictions THIS node influences

No outgoing edges.

Ticker exposure

22 ticker(s) linked

Beneficiaries (22)

USARALNTFANUYHSEHYIRBTLYSCFMPRNSHFSERVSYMMIELYTERPHTSLAAMZNBYDDYTXNSTMHYMTFIFNNYABBNYTEL

Prerequisites (4)

Predictions that must hit first
TypePredTitleDomainLag
correlateS_HUMANOID_CONSUMER_2030Humanoid R3: 1M+ consumer by Nov 2030humanoid_deployment
killerTK08Humanoid Capital Collapse (Figure/Apptronik Flop)
killerTK11Autonomous Regulatory Block (Level 4 Halt)
killerTK06China-Taiwan Military Conflict

Dependents (0)

Predictions enabled by this
TypePredTitleDomainLag
No dependents

Validations (1)

Resolution events
Observed atStatusByNotes
2026-04-29partialthesis_timeline_v1.0_importFigure, Tesla Optimus, Agility Digit, Apptronik, 1X, Sanctuary AI, Unitree, Xpeng — hundreds of humanoid companies confirm Cambrian framing. Municipal utility-grade deployment nascent.

Linked documents (2)

Auto-generated by cosine similarity from Polymarket / Manifold / EDGAR / GDELT
SimSourceTitleMarket probPolarityReviewedPublished
0.664arxivVASO: Formally Verifiable Self-Evolving Skills for Physical AI Agentsmentionspending2026-06-03
0.632arxivHeight Control and Optimal Torque Planning for Jumping With Wheeled-Bipedal Robotsmentionspending2026-05-05

Raw metadata

From Thesis_Timeline_v1.0_FINAL workbook
{
  "nia": false,
  "qty": "hundreds of bipedal companies",
  "mode": "FORECAST",
  "role": "Cited-Other",
  "context": "Third Wissner-Gross entry (SEM_032 Millennium Prize, 248_002 LEO-to-phone, AUT_002 unified substrate, IND_003 NICU 4hr). Specific bipedal-labor + municipal-utility framing complementing 237_018 (Cambrian OpenClaw variants).",
  "to_year": 2026,
  "conv_cues": "coined framing; specific utility-grade framing",
  "direction": "HAPPEN",
  "from_year": 2026,
  "timeframe": "2026",
  "conv_level": "HIGH",
  "milestones": [
    {
      "kind": "quartile_checkpoint",
      "label": "Q1 window check-in (25%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -5,
      "source_id": null,
      "expected_date": "2026-02-16",
      "observed_date": null,
      "miss_emitted_at": "2026-05-02T22:07:21.384228+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "llm_pre_event",
      "label": "Apptronik Apollo deployed at Mercedes-Benz manufacturing plant for tote delivery",
      "notes": "HIT — Apptronik raised $520M Feb 2026, Apollo in pilot at Mercedes for tote delivery; supports Cambrian-explosion-of-bipedal-labor thesis.",
      "source": "https://mlq.ai/news/apptronik-secures-520m-funding-boost-for-humanoid-robot-expansion/",
      "status": "hit",
      "weight": 0.4,
      "ordinal": -4,
      "source_id": null,
      "confidence": 0.95,
      "source_url": "https://mlq.ai/news/apptronik-secures-520m-funding-boost-for-humanoid-robot-expansion/",
      "expected_date": "2026-02-28",
      "observed_date": "2026-02-15",
      "research_origin": "deep_research",
      "measurement_criterion": "Apptronik publicly confirms Apollo humanoid robots in active commercial pilot at Mercedes-Benz facility (>=1 site)"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q2 window check-in (50%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -3,
      "source_id": null,
      "expected_date": "2026-04-04",
      "observed_date": null,
      "miss_emitted_at": "2026-05-02T22:07:21.384228+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "llm_pre_event",
      "label": "Figure 03 production reaches 1 robot/hour throughput at BotQ",
      "source": "https://www.humanoidsdaily.com/news/24x-throughput-figure-scales-manufacturing-to-one-robot-per-hour",
      "status": "hit",
      "weight": 0.4,
      "ordinal": -2,
      "source_id": null,
      "confidence": 0.95,
      "source_url": "https://www.humanoidsdaily.com/news/24x-throughput-figure-scales-manufacturing-to-one-robot-per-hour",
      "expected_date": "2026-04-15",
      "observed_date": "2026-04-15",
      "research_origin": "deep_research",
      "measurement_criterion": "Figure AI publicly reports BotQ producing 1 humanoid/hour (>=24x throughput improvement vs Jan 2026 rate of 1/day)"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q3 window check-in (75%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -1,
      "source_id": null,
      "expected_date": "2026-05-21",
      "observed_date": null,
      "miss_emitted_at": "2026-05-30T22:15:00.756418+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "event",
      "label": "'Cambrian explosion of bipedal labor' driven by hundreds of robotics companies — autonomy graduates from pilot programs to municipal public ",
      "status": "pending",
      "weight": 1,
      "ordinal": 0,
      "source_id": "IND_023",
      "expected_date": "2026-07-07",
      "observed_date": null
    },
    {
      "kind": "llm_pre_event",
      "label": "First city/state municipal humanoid-as-service contract announced",
      "notes": "Aggressive — to date (April 2026) deployments are manufacturing/logistics only; no public municipal contract yet. Gates the prediction's 'graduation to municipal public utilities' clause.",
      "source": "Industry track
... (truncated)